PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla015991
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family G2-like
Protein Properties Length: 384aa    MW: 42863.2 Da    PI: 7.62
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla015991genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.2e-31238293156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+peLH+rF +a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Cla015991 238 KQRRCWSPELHRRFENALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 293
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.084235295IPR017930Myb domain
SuperFamilySSF466894.49E-18236296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28236296IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-26238293IPR006447Myb domain, plants
PfamPF002491.3E-7240291IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MPSLSPPNTI SDFLRQISLL SNPSDRASRL DSFVTSLEDE MKKIDAFKRE LPLCMLLLND  60
AILALKDSSL QCASSCSSPK PKPVLEEFMS LNKDSSDENE KEQDCRDKKE WMSSVQLWKT  120
DDFQNTQIKT KRNEGWGYVA AAEDRFQLCR KKNEERLVVG FKSSSSAFPA MAAVKKEEKI  180
ESPICALSLV TPSLKNTREE LVSCVLRSSG NRATSTSTAD IQLNLRTVLP PQQQPTRKQR  240
RCWSPELHRR FENALQQLGG SQVATPKQIR ELMQVDGLTN DEVKSHLQKY RLHTRRLPST  300
PAARAGDQSP VVLGDLWMSQ DGCGESSKVS SSQSASPQGP LQFAGNGGYS TTGGDSMEDE  360
EDTKSESYDY WKSQAHTGKR CINI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817921e-129LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132551e-129LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008454913.10.0PREDICTED: putative two-component response regulator ARR13
TrEMBLA0A0A0K4U60.0A0A0A0K4U6_CUCSA; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-49G2-like family protein